Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATD3A Rabbit Polyclonal Antibody (Biotin)

GATD3A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ES1, HES1, KNPH, KNPI, GATD3, GT335, C21orf33

UniProt

P30042

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf33

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_937798

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPN1 Peptide - middle region
orb1999851 100 µg

EPN1 Peptide - middle region

Sign In for Pricing
View Details
Lentiviral mouse Ptp4a1 shRNA (UAS) - Lentiviral mouse Ptp4a1 shRNA (UAS, iRFP) (25)
GTR15166946 1 Vial

Lentiviral mouse Ptp4a1 shRNA (UAS) - Lentiviral mouse Ptp4a1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Human LAP (TGF-Beta1) ELISA Kit
orb1657934 96 Tests

Human LAP (TGF-Beta1) ELISA Kit

Sign In for Pricing
View Details
GPSM1 Protein Vector (Mouse) (pPM-C-His)
PV186421 500 ng

GPSM1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
P4HB Rabbit Polyclonal Antibody (Biotin)
orb2601933 100 µg

P4HB Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
ZKSCAN1, ID (ZKSCAN1, KOX18, ZNF139, ZNF36, Zinc finger protein with KRAB and SCAN domains 1, Zinc finger protein 139, Zinc finger protein 36, Zinc finger protein KOX18) (Biotin) discontinued
044090-Biotin 200 µL

ZKSCAN1, ID (ZKSCAN1, KOX18, ZNF139, ZNF36, Zinc finger protein with KRAB and SCAN domains 1, Zinc finger protein 139, Zinc finger protein 36, Zinc finger protein KOX18) (Biotin) discontinued

Sign In for Pricing
View Details