Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPN1 Peptide - middle region

EPN1 Peptide - middle region

Product Specifications

UniProt

Q9Y6I3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001123543.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLPMDYVQRVKRTHSQGGYGSQGYKYNWKLDEARKNLLRTHTTSASARAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetyltaurine
TRC-A189725-50MG 50 mg

Acetyltaurine

Sign In for Pricing
View Details
Neutravidin Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS
MTB21F4-NA 10x 96 Well Plates

Neutravidin Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS

Sign In for Pricing
View Details
Human TMEM138 activation kit by CRISPRa
GA109851 1 Kit

Human TMEM138 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human Osteomodulin/OMD Protein (His Tag)
PKSH031406 50 µg

Recombinant Human Osteomodulin/OMD Protein (His Tag)

Sign In for Pricing
View Details
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3048), CF488A conjugate, 0.1mg/mL
BNC883048-100 1x 100 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3048), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Butyl Phthalyl Butyl Glycolate
TRC-B810420-500MG 500 mg

Butyl Phthalyl Butyl Glycolate

Sign In for Pricing
View Details