Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LCAT Rabbit Polyclonal Antibody (FITC)

LCAT Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P04180

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LCAT

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVI

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000220

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-CMV-Eeig1-3xFLAG-CopGFP-Puro Plasmid
PVT82210 2 µg

PLV3-CMV-Eeig1-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF879 Antibody [PE]
NBP2-98028PE 0.1 mL

Rabbit Polyclonal ZNF879 Antibody [PE]

Sign In for Pricing
View Details
Collagen Alpha-1 III Chain (COL3A1) Antibody
abx159448-01 50 µg

Collagen Alpha-1 III Chain (COL3A1) Antibody

Sign In for Pricing
View Details
Collagen Alpha-1 III Chain (COL3A1) Antibody
abx159448-02 100 µg

Collagen Alpha-1 III Chain (COL3A1) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Sars Spike Protein Antibody (17F706R) [DyLight 680]
NBP2-90999FR 0.1 mL

Mouse Monoclonal Sars Spike Protein Antibody (17F706R) [DyLight 680]

Sign In for Pricing
View Details
SPAG6 Rabbit Polyclonal Antibody (Biotin)
orb2107363 100 µL

SPAG6 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details