Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAG6 Rabbit Polyclonal Antibody (Biotin)

SPAG6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Pf16, CT141, FAP194, CFAP194, Repro-SA-1

UniProt

O75602

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SPAG6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036575

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenyl 2-Chloroethyl Ether
TRC-P319625-25G 25 g

Phenyl 2-Chloroethyl Ether

Sign In for Pricing
View Details
UBE2S (Ubiquitin-conjugating Enzyme E2S, E2-EPF, E2EPF, EPF5) (MaxLight 650)
253215-ML650 100 µL

UBE2S (Ubiquitin-conjugating Enzyme E2S, E2-EPF, E2EPF, EPF5) (MaxLight 650)

Sign In for Pricing
View Details
Ppic antibody - N-terminal region
MBS3207336-01 0.1 mL

Ppic antibody - N-terminal region

Sign In for Pricing
View Details
Ppic antibody - N-terminal region
MBS3207336-02 5x 0.1 mL

Ppic antibody - N-terminal region

Sign In for Pricing
View Details
Sheep Anti-86 kDa subunit of Ku antibody ELISA Kit
MBS749387-01 48 Well

Sheep Anti-86 kDa subunit of Ku antibody ELISA Kit

Sign In for Pricing
View Details
Sheep Anti-86 kDa subunit of Ku antibody ELISA Kit
MBS749387-02 96 Well

Sheep Anti-86 kDa subunit of Ku antibody ELISA Kit

Sign In for Pricing
View Details