Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAA Rabbit Polyclonal Antibody (HRP)

GAA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LYAG

UniProt

P10253

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence APTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRST

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRST

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

105 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

NCBI Accession Number

NP_000143

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMS-538305 (hydrochloride)
HY-120631A 1 Each

BMS-538305 (hydrochloride)

Sign In for Pricing
View Details
Tafa5 (NM_134096) Mouse Untagged Clone
MC212122 10 µg

Tafa5 (NM_134096) Mouse Untagged Clone

Sign In for Pricing
View Details
EYA1 siRNA Oligos set (Human)
19593171 3x 5 nmol

EYA1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Human Cadherin-12, CDH12 ELISA KIT
ELI-50368h 96 Tests

Human Cadherin-12, CDH12 ELISA KIT

Sign In for Pricing
View Details
HHV-8 K14 (OX112)
sc-53071 200 µg/mL

HHV-8 K14 (OX112)

Sign In for Pricing
View Details
Porcine Breast carcinoma-amplified sequence 1 (BCAS1) ELISA Kit
MBS7250086-01 48 Well

Porcine Breast carcinoma-amplified sequence 1 (BCAS1) ELISA Kit

Sign In for Pricing
View Details