Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLG7 Rabbit Polyclonal Antibody (FITC)

DLG7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DLG7, HURP

UniProt

Q15398

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DLG7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055565

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRAS G12C inhibitor 56
HY-148261 1 Each

KRAS G12C inhibitor 56

Sign In for Pricing
View Details
Human Interferon-induced protein with tetratricopeptide repeats 1, IFIT1 ELISA Kit
MBS925861-01 24 Well (Limit 1)

Human Interferon-induced protein with tetratricopeptide repeats 1, IFIT1 ELISA Kit

Sign In for Pricing
View Details
Human Interferon-induced protein with tetratricopeptide repeats 1, IFIT1 ELISA Kit
MBS925861-02 48 Well

Human Interferon-induced protein with tetratricopeptide repeats 1, IFIT1 ELISA Kit

Sign In for Pricing
View Details
Human Interferon-induced protein with tetratricopeptide repeats 1, IFIT1 ELISA Kit
MBS925861-03 96 Well

Human Interferon-induced protein with tetratricopeptide repeats 1, IFIT1 ELISA Kit

Sign In for Pricing
View Details
Human Interferon-induced protein with tetratricopeptide repeats 1, IFIT1 ELISA Kit
MBS925861-04 5x 96 Well

Human Interferon-induced protein with tetratricopeptide repeats 1, IFIT1 ELISA Kit

Sign In for Pricing
View Details
Human Interferon-induced protein with tetratricopeptide repeats 1, IFIT1 ELISA Kit
MBS925861-05 10x 96 Well

Human Interferon-induced protein with tetratricopeptide repeats 1, IFIT1 ELISA Kit

Sign In for Pricing
View Details