Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM82B Rabbit Polyclonal Antibody (HRP)

FAM82B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RMD1, RMD-1, CGI-90, FAM82B

UniProt

Q96DB5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM82B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_057117

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Etv3l Rabbit Polyclonal Antibody (HRP)
orb2115134 100 µL

Etv3l Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
GIF (Gastric Intrinsic Factor, Intrinsic Factor, IF, INF, IFMH) (MaxLight 405)
MBS6190326-01 0.1 mL

GIF (Gastric Intrinsic Factor, Intrinsic Factor, IF, INF, IFMH) (MaxLight 405)

Sign In for Pricing
View Details
GIF (Gastric Intrinsic Factor, Intrinsic Factor, IF, INF, IFMH) (MaxLight 405)
MBS6190326-02 5x 0.1 mL

GIF (Gastric Intrinsic Factor, Intrinsic Factor, IF, INF, IFMH) (MaxLight 405)

Sign In for Pricing
View Details
Creg1 Rat Pre-designed siRNA Set A
HY-RS25915 1 Set

Creg1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
UBQLN2 siRNA Oligos set (Human)
49040171 3x 5 nmol

UBQLN2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Tbc1d9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
46269114 3x 1.0 µg

Tbc1d9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details