Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Etv3l Rabbit Polyclonal Antibody (HRP)

Etv3l Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1562620

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Etv3l

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGLAFPDWAYKAESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001094462

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Monkey TNFRSF4 Protein, Fc-tagged, FITC conjugated
TNFRSF4-549RF 20 μg- 50 μg- 100 μg

Recombinant Monkey TNFRSF4 Protein, Fc-tagged, FITC conjugated

Sign In for Pricing
View Details
ACO1 (Cytoplasmic Aconitate Hydratase, Aconitase, Citrate Hydro-lyase, Ferritin Repressor Protein, Iron Regulatory Protein 1, IRP1, Iron-responsive Element-binding Protein 1, IRE-BP 1, IREB1) (AP) discontinued
122877-AP 100 µL

ACO1 (Cytoplasmic Aconitate Hydratase, Aconitase, Citrate Hydro-lyase, Ferritin Repressor Protein, Iron Regulatory Protein 1, IRP1, Iron-responsive Element-binding Protein 1, IRE-BP 1, IREB1) (AP) discontinued

Sign In for Pricing
View Details
pENTR223-GSTM4 Plasmid
PVT11468 2 µg

pENTR223-GSTM4 Plasmid

Sign In for Pricing
View Details
PriB Antibody
orb824200 2 mg

PriB Antibody

Sign In for Pricing
View Details
MMP13 Rabbit pAb, BF488 conjugated
orb2824151 100 µL

MMP13 Rabbit pAb, BF488 conjugated

Sign In for Pricing
View Details
Rabbit Anti-GRP75 antibody
SL1469R-01 50 µL

Rabbit Anti-GRP75 antibody

Sign In for Pricing
View Details