Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SILV Rabbit Polyclonal Antibody (HRP)

SILV Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P1, SI, SIL, ME20, P100, SILV, ME20M, gp100, ME20-M, PMEL17, D12S53E

UniProt

P40967

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SILV

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_008859

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS804938 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Ripasudil Hydrochloride
TRC-R517900-25MG 25 mg

Ripasudil Hydrochloride

Sign In for Pricing
View Details
SFMBT1 (NM_001005158) Human Over-expression Lysate
LY423945 100 µg

SFMBT1 (NM_001005158) Human Over-expression Lysate

Sign In for Pricing
View Details
KLC2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E7]
TA811472AM 100 µL

KLC2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E7]

Sign In for Pricing
View Details
iFluor™ 488 Conjugated BRG1 Recombinant Rabbit Monoclonal Antibody [SN20-03]
HA720177F 100 µL

iFluor™ 488 Conjugated BRG1 Recombinant Rabbit Monoclonal Antibody [SN20-03]

Sign In for Pricing
View Details
Art2a Rabbit Polyclonal Antibody
TA363429 100 µL

Art2a Rabbit Polyclonal Antibody

Sign In for Pricing
View Details