Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDH12 Rabbit Polyclonal Antibody (HRP)

PCDH12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DMJDS1, VECAD2, VE-cadherin-2

UniProt

Q9NPG4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PCDH12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

126kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_057664

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3.1 (HIST1H3J, Histone H3K79me3, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, _+E_Histone H3/k, Histone H3/l, HIST3H3) (PE)
MBS6420665-01 0.1 mL

Histone H3.1 (HIST1H3J, Histone H3K79me3, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, _+E_Histone H3/k, Histone H3/l, HIST3H3) (PE)

Sign In for Pricing
View Details
Histone H3.1 (HIST1H3J, Histone H3K79me3, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, _+E_Histone H3/k, Histone H3/l, HIST3H3) (PE)
MBS6420665-02 5x 0.1 mL

Histone H3.1 (HIST1H3J, Histone H3K79me3, H3/j, H3FJ, Histone H3/a, Histone H3/b,Histone H3/c, Histone H3/d, Histone H3/f,Histone H3/h, Histone H3/I,Histone H3/j, _+E_Histone H3/k, Histone H3/l, HIST3H3) (PE)

Sign In for Pricing
View Details
Mouse Camk2g Pre-designed siRNA Set B
SI101744B 1 Each

Mouse Camk2g Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-Zebrafish PDCD10a/b Antibody PE Conjugated
AZQ6PHH3-PE 100 µg/Vial

Anti-Zebrafish PDCD10a/b Antibody PE Conjugated

Sign In for Pricing
View Details
PF-543 hydrochloride
orb1218649-01 200 mg

PF-543 hydrochloride

Sign In for Pricing
View Details
PF-543 hydrochloride
orb1218649-02 500 mg

PF-543 hydrochloride

Sign In for Pricing
View Details