Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LASS6 Rabbit Polyclonal Antibody (FITC)

LASS6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CERS5, LASS6

UniProt

Q6ZMG9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LASS6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAGILAWFWNERFWLPHNVTWADLKNTEEATFPQAEDLYLAFPLAFCIFM

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_982288

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant UPF0266 membrane protein yobD (yobD)
orb2931571-01 20 µg

Recombinant UPF0266 membrane protein yobD (yobD)

Sign In for Pricing
View Details
Recombinant UPF0266 membrane protein yobD (yobD)
orb2931571-02 100 µg

Recombinant UPF0266 membrane protein yobD (yobD)

Sign In for Pricing
View Details
ARL1 Protein Vector (Mouse) (pPM-C-HA)
PV156112 500 ng

ARL1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
EBAG9 (Receptor-binding Cancer Antigen Expressed on SiSo Cells, Cancer-associated Surface Antigen RCAS1, Estrogen Receptor-binding Fragment-associated Gene 9 Protein, RCAS1)
E0255-55D 100 µg

EBAG9 (Receptor-binding Cancer Antigen Expressed on SiSo Cells, Cancer-associated Surface Antigen RCAS1, Estrogen Receptor-binding Fragment-associated Gene 9 Protein, RCAS1)

Sign In for Pricing
View Details
TNFRSF14, NT (TNF Receptor-like 2, ATAR, CD270, Herpes virus Entry Mediator A, HVEA, Herpes virus Entry Mediator, HVEM, LIGHTR, TR2, Tumor Necrosis Factor Receptor Superfamily Member 14) (MaxLight 490) discontinued
T9162-79C-ML490 100 µL

TNFRSF14, NT (TNF Receptor-like 2, ATAR, CD270, Herpes virus Entry Mediator A, HVEA, Herpes virus Entry Mediator, HVEM, LIGHTR, TR2, Tumor Necrosis Factor Receptor Superfamily Member 14) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Mosquito flavivirus Core Protein, N-His-SUMO
MBS1578541-01 0.1 mg

Recombinant Mosquito flavivirus Core Protein, N-His-SUMO

Sign In for Pricing
View Details