Recombinant UPF0266 membrane protein yobD (yobD)
This Recombinant UPF0266 membrane protein yobD (yobD) spans the amino acid sequence from region 1-152.
Product Specifications
Product Name Alternative
UPF0266 membrane protein yobD
UniProt
P67602
Expression Region
1-152
Origin
Escherichia coli O6
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTITDLVLILFIAALLAFAIYDQFIMPRRNGPTLLAIPLLRRGRIDSVIFVGLIVILIYN NVTNHGALITTWLLSALALMGFYIFWIRVPKIIFKQKGFFFANVWIEYSRIKAMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKLLVSTQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680050-100 1x 100 µL
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680227-500 1x 500 µL
Milk Fat Globulin (MFG-06), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details