Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REC8 Rabbit Polyclonal Antibody (HRP)

REC8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rec8p, REC8L1, HR21spB

UniProt

O95072

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human REC8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_005123

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Growth Arrest Specific Protein 1 (GAS1) ELISA Kit
MBS9349413 Inquire

Pigeon Growth Arrest Specific Protein 1 (GAS1) ELISA Kit

Sign In for Pricing
View Details
CHMP4B Rabbit Polyclonal Antibody (HRP)
orb2107901 100 µL

CHMP4B Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
CTHM sgRNA CRISPR Lentivector set (Human)
K0526601 3x 1.0 µg

CTHM sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Murine IL-4 ELISA Kit
M660020192 2x 96 Well

Murine IL-4 ELISA Kit

Sign In for Pricing
View Details
Connexin 30.3 (CX30.3, Gap Junction Beta 5 Protein, CXB5) (AP)
MBS6470057-01 0.1 mL

Connexin 30.3 (CX30.3, Gap Junction Beta 5 Protein, CXB5) (AP)

Sign In for Pricing
View Details
Connexin 30.3 (CX30.3, Gap Junction Beta 5 Protein, CXB5) (AP)
MBS6470057-02 5x 0.1 mL

Connexin 30.3 (CX30.3, Gap Junction Beta 5 Protein, CXB5) (AP)

Sign In for Pricing
View Details