Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHMP4B Rabbit Polyclonal Antibody (HRP)

CHMP4B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SNF7, CTPP3, Shax1, CHMP4A, SNF7-2, VPS32B, CTRCT31, Vps32-2, C20orf178, dJ553F4.4

UniProt

Q9H444

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CHMP4B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_789782

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Calcium Activated Nucleotidase 1/CANT1 Antibody (OTI7F8) - Azide and BSA Free
NBP2-72378 100 µg

Mouse Monoclonal Calcium Activated Nucleotidase 1/CANT1 Antibody (OTI7F8) - Azide and BSA Free

Sign In for Pricing
View Details
Mouse Monoclonal SARS-CoV-2 Spike S1 Protein Antibody (1035206) [Janelia Fluor 669]
FAB105403JF669 0.1 mL

Mouse Monoclonal SARS-CoV-2 Spike S1 Protein Antibody (1035206) [Janelia Fluor 669]

Sign In for Pricing
View Details
Olfr44 ORF Vector (Mouse) (pORF)
33152014 1.0 µg DNA

Olfr44 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse Fibrinopeptide A (FPA) ELISA Kit-Competitive
EK5F821 96 Tests

Mouse Fibrinopeptide A (FPA) ELISA Kit-Competitive

Sign In for Pricing
View Details
IRF8 (NM_002163) Human Over-expression Lysate
LY419485 100 µg

IRF8 (NM_002163) Human Over-expression Lysate

Sign In for Pricing
View Details
Guanylate Cyclase Activator 2A (GUCA2A) Magnetic Luminex Assay Kit
LKU604952 96 Tests

Guanylate Cyclase Activator 2A (GUCA2A) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details