Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDCD1 Rabbit Polyclonal Antibody (HRP)

NUDCD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CML66, OVA66

UniProt

Q96RS6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NUDCD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KEGRQVGQVAKQQVASLETNDPILGFQATNERLFVLTTKNLFLIKVNTEN

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_116258

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human ERP44 protein
ATGP0678-020 20 µg

Recombinant human ERP44 protein

Sign In for Pricing
View Details
Monkey Checkpoint protein HUS1 (HUS1) ELISA Kit
GTR10369223 96 Well

Monkey Checkpoint protein HUS1 (HUS1) ELISA Kit

Sign In for Pricing
View Details
GLR Antibody
ABD4937 100 µg

GLR Antibody

Sign In for Pricing
View Details
RPL26 Antibody - C-terminal region : Biotin (ARP61599_P050-Biotin)
ARP61599_P050-Biotin 100 µL

RPL26 Antibody - C-terminal region : Biotin (ARP61599_P050-Biotin)

Sign In for Pricing
View Details
Purple sea urchin Integrin B1A Rabbit Polyclonal Antibody (FITC)
orb2570704 200 µL

Purple sea urchin Integrin B1A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
HCFC1 Antibody
CSB-PA914205 100 µL

HCFC1 Antibody

Sign In for Pricing
View Details