Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naa60 Rabbit Polyclonal Antibody (Biotin)

Naa60 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HAT4, NatF, Nat15, RGD1308915

UniProt

Q3MHC1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Naa60

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IVGMIVAEIKNRTKIHKEDGDILASSFSVDTQVAYILSLGVVKEFRKHGI

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001014248

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Dual oxidase maturation factor 2 (DUOXA2)
orb2915499-01 20 µg

Recombinant Human Dual oxidase maturation factor 2 (DUOXA2)

Sign In for Pricing
View Details
Recombinant Human Dual oxidase maturation factor 2 (DUOXA2)
orb2915499-02 100 µg

Recombinant Human Dual oxidase maturation factor 2 (DUOXA2)

Sign In for Pricing
View Details
PcDNA3.1 (+) -3*HA-ALKBH5
PPL01983-2a 1 Each

PcDNA3.1 (+) -3*HA-ALKBH5

Sign In for Pricing
View Details
Acetone 1% w/v Solution
0029I 01000 1 L

Acetone 1% w/v Solution

Sign In for Pricing
View Details
Lentiviral mouse Dnajb12 shRNA (UAS) - Lentiviral mouse Dnajb12 shRNA (UAS, RFP) (100)
GTR15170928 1 Vial

Lentiviral mouse Dnajb12 shRNA (UAS) - Lentiviral mouse Dnajb12 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
DUSP9 (Dual Specificity Protein Phosphatase 9, Mitogen-activated Protein Kinase Phosphatase 4, MAP Kinase Phosphatase 4, MKP-4, MKP4) (Biotin)
126075-Biotin 100 µL

DUSP9 (Dual Specificity Protein Phosphatase 9, Mitogen-activated Protein Kinase Phosphatase 4, MAP Kinase Phosphatase 4, MKP-4, MKP4) (Biotin)

Sign In for Pricing
View Details