Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dual oxidase maturation factor 2 (DUOXA2)

This Recombinant Human Dual oxidase maturation factor 2 (DUOXA2) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Dual oxidase maturation factor 2, Dual oxidase activator 2

UniProt

Q1HG44

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLWNGVLPFYPQPRHAAGFSVPLLIVILVFLALAASFLLILPGIRGHSRWFWLVRVLLS LFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARVRLLVGLEGINITLTGTPVHQL NETIDYNEQFTWRLKENYAAEYANALEKGLPDPVLYLAEKFTPSSPCGLYHQYHLAGHYA SATLWVAFCFWLLSNVLLSTPAPLYGGLALLTTGAFALFGVFALASISSVPLCPLRLGSS ALTTQYGAAFWVTLATGVLCLFLGGAVVSLQYVRPSALRTLLDQSAKDCSQERGGSPLIL GDPLHKQAALPDLKCITTNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3529), CF568 conjugate, 0.1mg/mL
BNC683529-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3529), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Palmitic Acid-d31
TRC-P144501-250MG 250 mg

Palmitic Acid-d31

Sign In for Pricing
View Details
Human FRG2B activation kit by CRISPRa
GA118521 1 Kit

Human FRG2B activation kit by CRISPRa

Sign In for Pricing
View Details
IFNA2 Antibody
KC-040-01 50 μL

IFNA2 Antibody

Sign In for Pricing
View Details
IFNA2 Antibody
KC-040-02 100 µL

IFNA2 Antibody

Sign In for Pricing
View Details
IFNA2 Antibody
KC-040-03 1 mL

IFNA2 Antibody

Sign In for Pricing
View Details