Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3A Rabbit Polyclonal Antibody (HRP)

POLR3A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ADDH, C160, HLD7, RPC1, WDRTS, RPC155, hRPC155

UniProt

O14802

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POLR3A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

156kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_008986

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PF4 Matched Antibody Pair Set [ABP-S-052245]
ABP-S-052245 5 Plates

Human PF4 Matched Antibody Pair Set [ABP-S-052245]

Sign In for Pricing
View Details
LRATD2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G5]
TA501922AM 100 µL

LRATD2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G5]

Sign In for Pricing
View Details
Recombinant Human NOTCH2 Protein, C-Fc
E55P3742 50 µg

Recombinant Human NOTCH2 Protein, C-Fc

Sign In for Pricing
View Details
Rat Pgm2 Pre-designed siRNA Set A
SI210369A 1 Each

Rat Pgm2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Kolavenic acid analog
HY-146146 1 Each

Kolavenic acid analog

Sign In for Pricing
View Details
MST1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV647164 1.0 µg DNA

MST1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details