Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSGlcA-T Rabbit Polyclonal Antibody (HRP)

CSGlcA-T Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ChSy-3, chPF-2, CSGlcAT, CSGLCA-T

UniProt

Q9P2E5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CSGlcA-T

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLLRVSWIQGEGEDPCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

EAW54012

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p38 MAP Kinase Blocking Peptide
3114BP-50 50 μg

p38 MAP Kinase Blocking Peptide

Sign In for Pricing
View Details
GSTK1 Knockout HEK293T Polyclonal Cells
ARG26001 1 Million

GSTK1 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
PRDM10 Peptide - middle region
orb2009422 100 µg

PRDM10 Peptide - middle region

Sign In for Pricing
View Details
Nsf Antibody (FITC)
orb241321-01 50 µg

Nsf Antibody (FITC)

Sign In for Pricing
View Details
Nsf Antibody (FITC)
orb241321-02 100 µg

Nsf Antibody (FITC)

Sign In for Pricing
View Details
TFCP2 (Alpha-globin Transcription Factor CP2, SAA3 Enhancer Factor, Transcription Factor LSF, LSF, SEF) (Biotin)
MBS6396337-01 0.1 mL

TFCP2 (Alpha-globin Transcription Factor CP2, SAA3 Enhancer Factor, Transcription Factor LSF, LSF, SEF) (Biotin)

Sign In for Pricing
View Details