Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM10 Peptide - middle region

PRDM10 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1231, MGC131802, PFM7

UniProt

Q9NQV6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRDM10 Rabbit Polyclonal Antibody (orb330052) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064613

Preservative

Lyophilized powder

AA Sequence

VATPVTTGQVKAVTSGHYVLSESQSELEEKQTSALSGGVQVEPPAHSDSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stk3 Mouse Gene Knockout Kit (CRISPR)
KN516875 1 Kit

Stk3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse CCL4 protein (His Tag)
PKSM041505-01 20 µg

Recombinant Mouse CCL4 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CCL4 protein (His Tag)
PKSM041505-02 100 µg

Recombinant Mouse CCL4 protein (His Tag)

Sign In for Pricing
View Details
TentaGel® M OH
M302000.1G 1 g

TentaGel® M OH

Sign In for Pricing
View Details
Ammonium Dichromate
TRC-A633980-50G 50 g

Ammonium Dichromate

Sign In for Pricing
View Details
SEC23B Mouse Monoclonal Antibody [Clone ID: OTI6E8]
CF810137 100 µg

SEC23B Mouse Monoclonal Antibody [Clone ID: OTI6E8]

Sign In for Pricing
View Details