Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOST, Human (Biotinylated, HEK293, His-Avi)

SOST proteins act as potent inhibitors of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. SOST exerts its inhibitory effect by interacting with key Wnt pathway components, including LRP4, LRP5, and LRP6. SOST Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived SOST protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

Product Specifications

Product Name Alternative

SOST Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sost-protein-human-biotinylated-hek293-his-avi.html

Purity

95.00

Smiles

QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY

Molecular Formula

50964 (Gene_ID) Q9BQB4-1 (Q24-Y213) (Accession)

Molecular Weight

28-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cephalosporin C analog-1
orb3173824-01 10 mg

Cephalosporin C analog-1

Sign In for Pricing
View Details
Cephalosporin C analog-1
orb3173824-02 50 mg

Cephalosporin C analog-1

Sign In for Pricing
View Details
Breast cancer suppressor candidate 1 (VWA5A) Mouse Monoclonal Antibody [Clone 3B4]
E45M10224V-2 50 µL

Breast cancer suppressor candidate 1 (VWA5A) Mouse Monoclonal Antibody [Clone 3B4]

Sign In for Pricing
View Details
Copovidone
GX9861-250g 250 g

Copovidone

Sign In for Pricing
View Details
Biotinylated Recombinant Cynomolgus FcRn Protein
RP02364 500 µg

Biotinylated Recombinant Cynomolgus FcRn Protein

Sign In for Pricing
View Details
DHX30 Protein Vector (Mouse) (pPM-C-HA)
18198025 500 ng

DHX30 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details