Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Human (His)

IL-33 protein, as a cytokine, binds to and signals through the IL1RL1/ST2 receptor, thereby activating the NF-kappa-B and MAPK signaling pathways in target cells. It is involved in the maturation of Th2 cells and contributes to the secretion of T helper cell type 2 related cytokines. IL-33 Protein, Human (His) is the recombinant human-derived IL-33 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-33 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-human-his.html

Purity

96.70

Smiles

SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Molecular Formula

90865 (Gene_ID) O95760-1 (S112-T270) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Kallikrein 12 ELISA Kit
OM625341 96 Strip Well

Bovine Kallikrein 12 ELISA Kit

Sign In for Pricing
View Details
PE-conjugated Anti-CD40 antibody (DM100), Rabbit mAb
MBS1882530-01 100 Tests

PE-conjugated Anti-CD40 antibody (DM100), Rabbit mAb

Sign In for Pricing
View Details
PE-conjugated Anti-CD40 antibody (DM100), Rabbit mAb
MBS1882530-02 5x 100 Tests

PE-conjugated Anti-CD40 antibody (DM100), Rabbit mAb

Sign In for Pricing
View Details
GPR113 Rabbit Polyclonal Antibody
E28PT1956 100 µL

GPR113 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HTATSF1 Antibody
orb1247377 0.1 mg

HTATSF1 Antibody

Sign In for Pricing
View Details
Human IgA2 (myeloma) purified
20007-7-500 500 µg

Human IgA2 (myeloma) purified

Sign In for Pricing
View Details