Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcn Rabbit Polyclonal Antibody (Biotin)

Porcn Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P, Mp, Ppn, Mg61, porc, Mporc, mMg61, AW045557, DXHXS7465, DXHXS7465e, 2410004O13Rik

UniProt

Q9JJJ7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VAMKAVSLGFDLDRGEVGAVPSPVEFMGYLYFVGTIVFGPWISFHSYLQA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_058609

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EPHA10 activation kit by CRISPRa
GA117172 1 Kit

Human EPHA10 activation kit by CRISPRa

Sign In for Pricing
View Details
Tsen15 Mouse Gene Knockout Kit (CRISPR)
KN518326 1 Kit

Tsen15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Texas Red Conjugated Goat Affinity Purified Antibody to Equine IgG
TAF-431-1 1 mL

Texas Red Conjugated Goat Affinity Purified Antibody to Equine IgG

Sign In for Pricing
View Details
Complement 3d (C3d) (Acute Humoral Rejection Marker) (C3D/2891), CF568 conjugate, 0.1mg/mL
BNC682891-100 1x 100 µL

Complement 3d (C3d) (Acute Humoral Rejection Marker) (C3D/2891), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR562337 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
USP5 Recombinant Rabbit Monoclonal Antibody [JE77-42]
HA722371 100 µL

USP5 Recombinant Rabbit Monoclonal Antibody [JE77-42]

Sign In for Pricing
View Details