Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAC2, Human (His)

The RAC2 protein is a plasma membrane-associated small GTPase that dynamically regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. In its active state, RAC2 regulates secretory function, phagocytosis, and epithelial cell polarization. RAC2 Protein, Human (His) is the recombinant human-derived RAC2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

RAC2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rac2-protein-human-his.html

Purity

98.0

Smiles

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRAC

Molecular Formula

5880 (Gene_ID) P15153 (M1-C189) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Troponin I fast skeletal muscle (TNNI2) (NM_003282) Human Tagged Lenti ORF Clone
RC205676L3 10 µg

Troponin I fast skeletal muscle (TNNI2) (NM_003282) Human Tagged Lenti ORF Clone

Ask
View Details
Lentiviral mouse Cnot4 shRNA (UAS) - Lentiviral mouse Cnot4 shRNA (UAS, iRFP) (25)
GTR15206882 1 Vial

Lentiviral mouse Cnot4 shRNA (UAS) - Lentiviral mouse Cnot4 shRNA (UAS, iRFP) (25)

Ask
View Details
Porcine Integrin Beta-1-Binding Protein 2 (ITGB1BP2) ELISA Kit
MBS9928336-01 48 Well

Porcine Integrin Beta-1-Binding Protein 2 (ITGB1BP2) ELISA Kit

Ask
View Details
Porcine Integrin Beta-1-Binding Protein 2 (ITGB1BP2) ELISA Kit
MBS9928336-02 96 Well

Porcine Integrin Beta-1-Binding Protein 2 (ITGB1BP2) ELISA Kit

Ask
View Details
Porcine Integrin Beta-1-Binding Protein 2 (ITGB1BP2) ELISA Kit
MBS9928336-03 5x 96 Well

Porcine Integrin Beta-1-Binding Protein 2 (ITGB1BP2) ELISA Kit

Ask
View Details
Porcine Integrin Beta-1-Binding Protein 2 (ITGB1BP2) ELISA Kit
MBS9928336-04 10x 96 Well

Porcine Integrin Beta-1-Binding Protein 2 (ITGB1BP2) ELISA Kit

Ask
View Details