Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMYD3 Rabbit Polyclonal Antibody (HRP)

SMYD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KMT3E, ZMYND1, ZNFN3A1, bA74P14.1

UniProt

Q9H7B4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SMYD3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_073580

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Calbindin 1 AssayLite™ Antibody (PerCP Conjugate)
30137-05171 5x 30 µg

Human Calbindin 1 AssayLite™ Antibody (PerCP Conjugate)

Sign In for Pricing
View Details
ATTO 700 Alkin
orb3133003-01 10 mg

ATTO 700 Alkin

Sign In for Pricing
View Details
ATTO 700 Alkin
orb3133003-02 50 mg

ATTO 700 Alkin

Sign In for Pricing
View Details
HNT (NTM) (NM_001144058) Human Tagged ORF Clone Lentiviral Particle
RC226879L3V 200 µL

HNT (NTM) (NM_001144058) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
C8orf78 sgRNA CRISPR Lentivector (Human) (Target 3)
K0263204 1.0 µg DNA

C8orf78 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PCDHB15 Protein Lysate
OCOA09474-20UG 20 µg

PCDHB15 Protein Lysate

Sign In for Pricing
View Details