Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF280A Rabbit Polyclonal Antibody (HRP)

ZNF280A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SUHW1, ZNF280, ZNF636, 3'OY11.1

UniProt

P59817

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF280A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WRHSRRRVLQCSKCRLQFLTLKEEIEHKTKDHQTFKKPEQLQGFPRETKV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_542778

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Centrosome and spindle pole associated protein 1 (CSPP1) ELISA Kit
GTR10352828 96 Well

Porcine Centrosome and spindle pole associated protein 1 (CSPP1) ELISA Kit

Sign In for Pricing
View Details
TCL-1A (A-6) : m-IgGκ BP-HRP Bundle
sc-523945 1 Kit

TCL-1A (A-6) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Human CFHR2 (Complement factor H-related protein 2) ELISA Kit
orb2647997-01 48 Tests

Human CFHR2 (Complement factor H-related protein 2) ELISA Kit

Sign In for Pricing
View Details
Human CFHR2 (Complement factor H-related protein 2) ELISA Kit
orb2647997-02 96 Tests

Human CFHR2 (Complement factor H-related protein 2) ELISA Kit

Sign In for Pricing
View Details
PROTAC CDK9 degrader-6
HY-149963 1 Each

PROTAC CDK9 degrader-6

Sign In for Pricing
View Details
100bp Ladder
NP041140500 500 μL

100bp Ladder

Sign In for Pricing
View Details