Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF526 Rabbit Polyclonal Antibody (HRP)

ZNF526 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZp762O059, KIAA1951, MGC4267

UniProt

Q8TF50

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF526

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DCGKRFTQSSNLQQHRRLHLRPVAFARAPRLPITGLYNKSPYYCGTCGRW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_597701

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF488A conjugate, 0.1mg/mL
BNC882552-100 1x 100 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FTLL2-set siRNA/shRNA/RNAi Lentivector (Human)
57713091 4x 500 ng

FTLL2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
PE anti-human CD279 (PD-1)
GT15786 100 Tests

PE anti-human CD279 (PD-1)

Sign In for Pricing
View Details
Recombinant human VEGF 121/VEGFA protein
ATGP0282-500 500 µg

Recombinant human VEGF 121/VEGFA protein

Sign In for Pricing
View Details
25-Hydroxyvitamin D3-d6
SL1008-1 1 mg

25-Hydroxyvitamin D3-d6

Sign In for Pricing
View Details
Coxsackie Virus B5 (MaxLight 490) discontinued
C7904-91G-ML490 100 µL

Coxsackie Virus B5 (MaxLight 490) discontinued

Sign In for Pricing
View Details