Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC5 Rabbit Polyclonal Antibody (HRP)

EXOC5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SEC10, HSEC10, SEC10P, PRO1912, SEC10L1

UniProt

O00471

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006535

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TriMethyl-Histone H3-K56 (Rabbit)
A122590 100 µL

Anti-TriMethyl-Histone H3-K56 (Rabbit)

Sign In for Pricing
View Details
GMP IL-18, Human (HEK293, His)
HY-P70760G 50 µg

GMP IL-18, Human (HEK293, His)

Sign In for Pricing
View Details
KRTAP5-10 ORF Vector (Human) (pORF)
ORF022550 1.0 µg DNA

KRTAP5-10 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Bovine Rho-related GTP-binding protein RhoC (RHOC) ELISA Kit
MBS7237612-01 48 Well

Bovine Rho-related GTP-binding protein RhoC (RHOC) ELISA Kit

Sign In for Pricing
View Details
Bovine Rho-related GTP-binding protein RhoC (RHOC) ELISA Kit
MBS7237612-02 96 Well

Bovine Rho-related GTP-binding protein RhoC (RHOC) ELISA Kit

Sign In for Pricing
View Details
Bovine Rho-related GTP-binding protein RhoC (RHOC) ELISA Kit
MBS7237612-03 5x 96 Well

Bovine Rho-related GTP-binding protein RhoC (RHOC) ELISA Kit

Sign In for Pricing
View Details