Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLK2 Rabbit Polyclonal Antibody (Biotin)

PLK2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SNK, hSNK, hPlk2

UniProt

Q9NYY3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMPSSLLAPAKHL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006613

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (CD8A), partial
CSB-YP004966BO-01 20 µg

Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (CD8A), partial

Sign In for Pricing
View Details
Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (CD8A), partial
CSB-YP004966BO-02 100 µg

Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (CD8A), partial

Sign In for Pricing
View Details
Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (CD8A), partial
CSB-YP004966BO-03 1 mg

Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (CD8A), partial

Sign In for Pricing
View Details
Recombinant Cholinergic Receptor, Muscarinic 1 (CHRM1)
TRV-0011871-01 10 µg

Recombinant Cholinergic Receptor, Muscarinic 1 (CHRM1)

Sign In for Pricing
View Details
Recombinant Cholinergic Receptor, Muscarinic 1 (CHRM1)
TRV-0011871-02 50 µg

Recombinant Cholinergic Receptor, Muscarinic 1 (CHRM1)

Sign In for Pricing
View Details
Recombinant Cholinergic Receptor, Muscarinic 1 (CHRM1)
TRV-0011871-03 100 µg

Recombinant Cholinergic Receptor, Muscarinic 1 (CHRM1)

Sign In for Pricing
View Details