Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (CD8A), partial

Product Specifications

Product Name Alternative

CD_antigen: CD8a

Abbreviation

Recombinant Bovine CD8A protein, partial

Gene Name

CD8A

UniProt

P31783

Expression Region

26-189aa

Organism

Bos taurus (Bovine)

Target Sequence

LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Immunology

Relevance

Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule

Molecular Weight

19.9 kDa

References & Citations

"Molecular cloning, reconstruction and expression of the gene encoding the alpha-chain of the bovine CD8 -- definition of three peptide regions conserved across species."Lalor P., Bucci C., Fornaro M., Rattazzi M.C., Nakauchi H., Herzenberg L.A., Alberti S.Immunology 76:95-102 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRB2 Rabbit Polyclonal Antibody
AP13279PU-N 400 µL

GRB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human B Cells,  15nm
GM-01-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human B Cells, 15nm

Sign In for Pricing
View Details
Gasdermin D (GSDMD) Rabbit Monoclonal Antibody [Clone ID: R06-5C5]
TA384336 100 µL

Gasdermin D (GSDMD) Rabbit Monoclonal Antibody [Clone ID: R06-5C5]

Sign In for Pricing
View Details
Tmc8 Mouse Gene Knockout Kit (CRISPR)
KN517665 1 Kit

Tmc8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human Merlin/NF2 protein (His Tag)
PDEH100698-01 20 µg

Recombinant Human Merlin/NF2 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Merlin/NF2 protein (His Tag)
PDEH100698-02 100 µg

Recombinant Human Merlin/NF2 protein (His Tag)

Sign In for Pricing
View Details