Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF8 Rabbit Polyclonal Antibody (FITC)

RASSF8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HOJ1, C12orf2

UniProt

Q8NHQ8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RASF8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RHLAPHENPIISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hist2h2bb (BC019122) Mouse Tagged ORF Clone
MG200575 10 µg

Hist2h2bb (BC019122) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Src Recombinant Rabbit Monoclonal Antibody [ST05-03]
ET1609-65 100 µL

Src Recombinant Rabbit Monoclonal Antibody [ST05-03]

Sign In for Pricing
View Details
PISD Mouse Monoclonal Antibody [Clone ID: OTI6C3]
CF807333 100 µg

PISD Mouse Monoclonal Antibody [Clone ID: OTI6C3]

Sign In for Pricing
View Details
Pyronil 45
TRC-P997650-250MG 250 mg

Pyronil 45

Sign In for Pricing
View Details
SAMD12 (NM_001101676) Human Over-expression Lysate
LY420327 100 µg

SAMD12 (NM_001101676) Human Over-expression Lysate

Sign In for Pricing
View Details
CD10 Recombinant Mouse Monoclonal Antibody [A1G3-R]
HA601246 100 µL

CD10 Recombinant Mouse Monoclonal Antibody [A1G3-R]

Sign In for Pricing
View Details