Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QTNF2 Rabbit Polyclonal Antibody (Biotin)

C1QTNF2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CTRP2, zacrp2

UniProt

Q9BXJ5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C1QT2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILALKQ

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Coagulation Factor XI (F11) ELISA Kit
orb780308-01 48 Tests

Rat Coagulation Factor XI (F11) ELISA Kit

Sign In for Pricing
View Details
Rat Coagulation Factor XI (F11) ELISA Kit
orb780308-02 96 Tests

Rat Coagulation Factor XI (F11) ELISA Kit

Sign In for Pricing
View Details
12:0 N-Biotinyl fatty acid, NHS
orb3144709-01 50 mg

12:0 N-Biotinyl fatty acid, NHS

Sign In for Pricing
View Details
12:0 N-Biotinyl fatty acid, NHS
orb3144709-02 10 mg

12:0 N-Biotinyl fatty acid, NHS

Sign In for Pricing
View Details
Anti-DDX27 Antibody Picoband® Fluoro647 Conjugated
A10439-1-Fluoro647 100 µg/Vial

Anti-DDX27 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
CARD11 (phospho-Ser652) rabbit pAb Antibody
orb1097236-01 50 μL

CARD11 (phospho-Ser652) rabbit pAb Antibody

Sign In for Pricing
View Details