Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM82A Rabbit Polyclonal Antibody (HRP)

FAM82A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RMD2, RMD4, RMD-2, FAM82A, BLOCK18, FAM82A1, PRO34163, PYST9371

UniProt

Q96LZ7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FAM82A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHLWYAV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_653314

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bordetella Pertussis rplF Protein (aa 1-177)
VAng-Lsx4702-500gEcoli 500 µg (E. coli)

Recombinant Bordetella Pertussis rplF Protein (aa 1-177)

Sign In for Pricing
View Details
Lentiviral mouse Wfdc17 shRNA (UAS) - Lentiviral mouse Wfdc17 shRNA (UAS) (25)
GTR15208937 1 Vial

Lentiviral mouse Wfdc17 shRNA (UAS) - Lentiviral mouse Wfdc17 shRNA (UAS) (25)

Sign In for Pricing
View Details
Luc/GFP Reporter Cell Line-A549
CSC-RR0256 One Frozen Vial

Luc/GFP Reporter Cell Line-A549

Sign In for Pricing
View Details
Mouse Surfactant Associated Protein A (SPA) ELISA Kit
orb2667250-01 48 Tests

Mouse Surfactant Associated Protein A (SPA) ELISA Kit

Sign In for Pricing
View Details
Mouse Surfactant Associated Protein A (SPA) ELISA Kit
orb2667250-02 96 Tests

Mouse Surfactant Associated Protein A (SPA) ELISA Kit

Sign In for Pricing
View Details
PIRC20 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV740448 1.0 µg DNA

PIRC20 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details