Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A48 Rabbit Polyclonal Antibody (HRP)

SLC25A48 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6ZT89

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human S2548

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRESMFGFFKGMSFPLASIAVYNSVVFGVFSNTQRFLSQHRCGEPEASPP

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BBC3 Polyclonal Antibody
E-AB-67059-01 60 µL

BBC3 Polyclonal Antibody

Sign In for Pricing
View Details
BBC3 Polyclonal Antibody
E-AB-67059-02 120 µL

BBC3 Polyclonal Antibody

Sign In for Pricing
View Details
BBC3 Polyclonal Antibody
E-AB-67059-03 200 µL

BBC3 Polyclonal Antibody

Sign In for Pricing
View Details
OR2A12 Peptide - C-terminal region
MBS3243591-01 0.1 mg

OR2A12 Peptide - C-terminal region

Sign In for Pricing
View Details
OR2A12 Peptide - C-terminal region
MBS3243591-02 5x 0.1 mg

OR2A12 Peptide - C-terminal region

Sign In for Pricing
View Details
Mouse Monoclonal Fc gamma RI/CD64 Antibody (10.1) [DyLight 650]
FAB1257W 0.1 mL

Mouse Monoclonal Fc gamma RI/CD64 Antibody (10.1) [DyLight 650]

Sign In for Pricing
View Details