Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM266 Rabbit Polyclonal Antibody (HRP)

TMEM266 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HVRP1, HsHVRP1, C15orf27, hTMEM266

UniProt

Q2M3C6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C15orf27

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PAGSAQTSPELEHRVSLFNQKNQEGFTVFQIRPVIHFQPTVPMLEDKFRS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689548

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]
E-AB-F1226UH-01 25 µg

PE/Cyanine7 Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]
E-AB-F1226UH-02 100 µg

PE/Cyanine7 Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]

Sign In for Pricing
View Details
HNF 4 alpha (HNF4A) Rabbit Polyclonal Antibody
AP12423PU-N 400 µL

HNF 4 alpha (HNF4A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse AST (Aspartate Aminotransferase) ELISA Kit
E-EL-M0160-01 24 Tests

Mouse AST (Aspartate Aminotransferase) ELISA Kit

Sign In for Pricing
View Details
Mouse AST (Aspartate Aminotransferase) ELISA Kit
E-EL-M0160-02 48 Tests

Mouse AST (Aspartate Aminotransferase) ELISA Kit

Sign In for Pricing
View Details
Mouse AST (Aspartate Aminotransferase) ELISA Kit
E-EL-M0160-03 96 Tests

Mouse AST (Aspartate Aminotransferase) ELISA Kit

Sign In for Pricing
View Details