Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HORMAD2 Rabbit Polyclonal Antibody (HRP)

HORMAD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT46.2

UniProt

Q8N7B1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HORMAD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHII

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_689723

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VCAM-1, Recombinant, Human (CD106 Antigen, INCAM 100, INCAM-100, L1CAM, Vascular Cell Adhesion Molecule 1, VCAM 1, VCAM1, Vascular Cell Adhesion Protein 1)
149759-01 50 µg

VCAM-1, Recombinant, Human (CD106 Antigen, INCAM 100, INCAM-100, L1CAM, Vascular Cell Adhesion Molecule 1, VCAM 1, VCAM1, Vascular Cell Adhesion Protein 1)

Sign In for Pricing
View Details
VCAM-1, Recombinant, Human (CD106 Antigen, INCAM 100, INCAM-100, L1CAM, Vascular Cell Adhesion Molecule 1, VCAM 1, VCAM1, Vascular Cell Adhesion Protein 1)
149759-02 100 µg

VCAM-1, Recombinant, Human (CD106 Antigen, INCAM 100, INCAM-100, L1CAM, Vascular Cell Adhesion Molecule 1, VCAM 1, VCAM1, Vascular Cell Adhesion Protein 1)

Sign In for Pricing
View Details
Caldesmon Rabbit Polyclonal Antibody (HRP)
orb479658 100 µL

Caldesmon Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Tyrosinase Antibody
F50331-0.08ML 0.08 mL

Tyrosinase Antibody

Sign In for Pricing
View Details
Phospho-FOXO4 (S262) Antibody
CSB-PA010206-01 50 µg

Phospho-FOXO4 (S262) Antibody

Sign In for Pricing
View Details
Phospho-FOXO4 (S262) Antibody
CSB-PA010206-02 100 µg

Phospho-FOXO4 (S262) Antibody

Sign In for Pricing
View Details