Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lacc1 Rabbit Polyclonal Antibody (Biotin)

Lacc1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

9030625A04Rik

UniProt

Q8BZT9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LERGGILPQNIQDQKEDLDLCTSCHPEKFFSHVRDGLNFGTQIGFISLRE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766076

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Whatman GFC 70mm Membrane Glass Microfibre
FIL4314 100 / PCK

Whatman GFC 70mm Membrane Glass Microfibre

Sign In for Pricing
View Details
LP-922761 hydrate
T62143 200 mg

LP-922761 hydrate

Sign In for Pricing
View Details
FATE1 Human Over-expression Lysate
orb1372247 20 µg

FATE1 Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse TNF Receptor Associated Factor 6 (TRAF6) Antibody Pair Kit (with Standard)
MBS2103658-01 5x 96 Tests

Mouse TNF Receptor Associated Factor 6 (TRAF6) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse TNF Receptor Associated Factor 6 (TRAF6) Antibody Pair Kit (with Standard)
MBS2103658-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse TNF Receptor Associated Factor 6 (TRAF6) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse TNF Receptor Associated Factor 6 (TRAF6) Antibody Pair Kit (with Standard)
MBS2103658-03 10x 96 Tests

Mouse TNF Receptor Associated Factor 6 (TRAF6) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details