Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPEM2 Rabbit Polyclonal Antibody (HRP)

SPEM2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C17orf74

UniProt

Q0P670

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CQ074

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KVQAADPAPPPTMFVPLSRNPGGNANYQVYDSLELKRQVQKSRARSSSLP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_783861

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Neutrophil Collagenase, MMP8 ELISA Kit
BPE055-01 96 Tests

Human Neutrophil Collagenase, MMP8 ELISA Kit

Sign In for Pricing
View Details
Human Neutrophil Collagenase, MMP8 ELISA Kit
BPE055-02 5x 96 Tests

Human Neutrophil Collagenase, MMP8 ELISA Kit

Sign In for Pricing
View Details
Human Neutrophil Collagenase, MMP8 ELISA Kit
BPE055-03 15 x 96 Tests

Human Neutrophil Collagenase, MMP8 ELISA Kit

Sign In for Pricing
View Details
Monoclonal Antibody to Fibroblast Growth Factor 1, Acidic (FGF1)
TRV-0032285-01 20 µL

Monoclonal Antibody to Fibroblast Growth Factor 1, Acidic (FGF1)

Sign In for Pricing
View Details
Monoclonal Antibody to Fibroblast Growth Factor 1, Acidic (FGF1)
TRV-0032285-02 100 µL

Monoclonal Antibody to Fibroblast Growth Factor 1, Acidic (FGF1)

Sign In for Pricing
View Details
Monoclonal Antibody to Fibroblast Growth Factor 1, Acidic (FGF1)
TRV-0032285-03 200 µL

Monoclonal Antibody to Fibroblast Growth Factor 1, Acidic (FGF1)

Sign In for Pricing
View Details