Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND2C Rabbit Polyclonal Antibody (HRP)

DENND2C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DJ1156J9.1

UniProt

Q68D51

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DENND2C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

100kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_940861

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis B virus pre-X protein Polyclonal Antibody, RBITC Conjugated
bs-2147R-RBITC 100 µL

Hepatitis B virus pre-X protein Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal IL-36 gamma/IL-1F9 Antibody (Jussy-1) [DyLight 488]
NBP3-11676G 0.1 mL

Mouse Monoclonal IL-36 gamma/IL-1F9 Antibody (Jussy-1) [DyLight 488]

Sign In for Pricing
View Details
TPI1 Antibody
OAGA08512-100UL 100 µL

TPI1 Antibody

Sign In for Pricing
View Details
Goat anti-Cathepsin D Polyclonal antibody
AB0043-200 600 µg

Goat anti-Cathepsin D Polyclonal antibody

Sign In for Pricing
View Details
PAS1C1 (LMNTD1) (NM_001145727) Human Tagged ORF Clone Lentiviral Particle
RC226918L4V 200 µL

PAS1C1 (LMNTD1) (NM_001145727) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal Histone H2B [ubiquitylated Lys123] Antibody (1B3F12/A9) [mFluor Violet 610 SE]
NBP2-54770MFV610 0.1 mL

Mouse Monoclonal Histone H2B [ubiquitylated Lys123] Antibody (1B3F12/A9) [mFluor Violet 610 SE]

Sign In for Pricing
View Details