Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ift88 Rabbit Polyclonal Antibody (FITC)

Ift88 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ttc10

UniProt

D4ACI9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MMENVHLAPETDEDDLYSGFNDYNPAYDTEELENDTGFQQAVRTSHGRRP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001100736, 157821925, B5WUVB49013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PACSIN3 (NM_016223) Human Over-expression Lysate
E45H10007-2 20 µg

PACSIN3 (NM_016223) Human Over-expression Lysate

Sign In for Pricing
View Details
IL1R2 Protein (C-cleavage, Human)
P525791 100 µg

IL1R2 Protein (C-cleavage, Human)

Sign In for Pricing
View Details
COX5B (Cytochrome C Oxidase Subunit 5B, Cytochrome C Oxidase Polypeptide VB Mitochondrial, Cytochrome C Oxidase Subunit Vb, COXVB) (Biotin)
MBS6141327-01 0.1 mL

COX5B (Cytochrome C Oxidase Subunit 5B, Cytochrome C Oxidase Polypeptide VB Mitochondrial, Cytochrome C Oxidase Subunit Vb, COXVB) (Biotin)

Sign In for Pricing
View Details
COX5B (Cytochrome C Oxidase Subunit 5B, Cytochrome C Oxidase Polypeptide VB Mitochondrial, Cytochrome C Oxidase Subunit Vb, COXVB) (Biotin)
MBS6141327-02 5x 0.1 mL

COX5B (Cytochrome C Oxidase Subunit 5B, Cytochrome C Oxidase Polypeptide VB Mitochondrial, Cytochrome C Oxidase Subunit Vb, COXVB) (Biotin)

Sign In for Pricing
View Details
Beta-Defensin 1 (DEFB1) Antibody
abx172062 1 mL

Beta-Defensin 1 (DEFB1) Antibody

Sign In for Pricing
View Details
Rat Rims1 / Regulating synaptic membrane exocytosis protein 1 Recombinant Protein
R13174r 1 Each

Rat Rims1 / Regulating synaptic membrane exocytosis protein 1 Recombinant Protein

Sign In for Pricing
View Details