Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSX2IP Rabbit Polyclonal Antibody (FITC)

SSX2IP Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ADIP, hMsd1

UniProt

Q9Y2D8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SSX2IP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_054740

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Anti-SYT1 antibody (Mouse mAb)
GB151130-50 50 μL

Recombinant Anti-SYT1 antibody (Mouse mAb)

Sign In for Pricing
View Details
Mouse Monoclonal Bromodeoxyuridine/BrdU Antibody (BU-1) [Janelia Fluor 646]
FAB7225J 0.1 mL

Mouse Monoclonal Bromodeoxyuridine/BrdU Antibody (BU-1) [Janelia Fluor 646]

Sign In for Pricing
View Details
Canine calumenin (CALU) ELISA Kit
NSL1555Ca 96 Tests

Canine calumenin (CALU) ELISA Kit

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase, Receptor Type R, NT (PTPRR, Receptor-type Tyrosine-protein Phosphatase R, R-PTP-R, Ch-1PTPase, DKFZp781C1038, ECPTP, EC-PTP, FLJ34328, MGC131968, MGC148170, Protein Tyrosine Phosphatase PCPTP1, NC-PTPCOM1, PCPTP1, PTPBR7, PTPRQ, PTP-SL) (MaxLight 750) discontinued
P9109-40R2-ML750 100 µL

Protein Tyrosine Phosphatase, Receptor Type R, NT (PTPRR, Receptor-type Tyrosine-protein Phosphatase R, R-PTP-R, Ch-1PTPase, DKFZp781C1038, ECPTP, EC-PTP, FLJ34328, MGC131968, MGC148170, Protein Tyrosine Phosphatase PCPTP1, NC-PTPCOM1, PCPTP1, PTPBR7, PTPRQ, PTP-SL) (MaxLight 750) discontinued

Sign In for Pricing
View Details
FAM120AOS (NM_198841) Human 3' UTR Clone
SC212611 10 µg

FAM120AOS (NM_198841) Human 3' UTR Clone

Sign In for Pricing
View Details
Recombinant Human RANK/TNFRSF11A/CD265 (C-6His)
32-8632-50 50 µg

Recombinant Human RANK/TNFRSF11A/CD265 (C-6His)

Sign In for Pricing
View Details