Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RANK/TNFRSF11A/CD265 (C-6His)

Source: Human Cells. MW :21.1kD. Recombinant Human Receptor Activator of NF-kappa-B is produced by our Mammalian expression system and the target gene encoding Ile30-Pro212 is expressed with a 6His tag at the C-terminus. Receptor Activator of Nuclear Factor kappa B (RANK), also known as CD265, TRANCE Receptor or TNFRSF11A, is member of the tumor necrosis factor receptor (TNFR) molecular superfamily. RANK is the receptor for RANK-Ligand (RANKL) and part of the RANK/RANKL/OPG signaling pathway that regulates osteoclast differentiation and activation. It plays a vital role in bone remodeling and repair, immune cell function, lymph node development, thermal regulation, and mammary gland development. RANK is constitutively expressed in skeletal muscle, thymus, liver, colon, small intestine, adrenal gland, osteoclast, mammary gland epithelial cells, prostate, vascular cell, and pancreas.

Product Specifications

Gene Name

TNFRSF11A

Gene ID

8792

UniProt

Q9Y6Q6

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLPVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

γ- (6-Aminohexyl) -GTP – ATTO-590
JBS-NU-834-590 120 µL

γ- (6-Aminohexyl) -GTP – ATTO-590

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1341911-01 0.02 mg (E-Coli)

Recombinant Streptomyces coelicolor Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1341911-02 0.1 mg (E-Coli)

Recombinant Streptomyces coelicolor Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1341911-03 0.02 mg (Yeast)

Recombinant Streptomyces coelicolor Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1341911-04 0.1 mg (Yeast)

Recombinant Streptomyces coelicolor Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1341911-05 0.02 mg (Baculovirus)

Recombinant Streptomyces coelicolor Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details