Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHF5A Rabbit Polyclonal Antibody (HRP)

PHF5A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

INI, Rds3, SF3B7, SAP14b, SF3b14b, bK223H9.2

UniProt

Q7RTV0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PHF5A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_116147

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cpne7 Antibody - C-terminal region
ARP55052_P050-25UL 25 µL

Cpne7 Antibody - C-terminal region

Sign In for Pricing
View Details
Rarb (NM_011243) Mouse Tagged Lenti ORF Clone
MR207145L4 10 µg

Rarb (NM_011243) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Tbkbp1 shRNA (UAS) - Lentiviral mouse Tbkbp1 shRNA (UAS, RFP) (25)
GTR15237359 1 Vial

Lentiviral mouse Tbkbp1 shRNA (UAS) - Lentiviral mouse Tbkbp1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Anti-Actinin Alpha 4 ACTN4 Antibody
A01975 100 µL

Anti-Actinin Alpha 4 ACTN4 Antibody

Sign In for Pricing
View Details
Ethyl (5Z,8Z,11Z,14Z,17E) -Icosa-5,8,11,14,17-Pentaenoate
RG-M082570-01 10 mg

Ethyl (5Z,8Z,11Z,14Z,17E) -Icosa-5,8,11,14,17-Pentaenoate

Sign In for Pricing
View Details
Ethyl (5Z,8Z,11Z,14Z,17E) -Icosa-5,8,11,14,17-Pentaenoate
RG-M082570-02 25 mg

Ethyl (5Z,8Z,11Z,14Z,17E) -Icosa-5,8,11,14,17-Pentaenoate

Sign In for Pricing
View Details