Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIL3 Rabbit Polyclonal Antibody (HRP)

PPIL3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CYPJ

UniProt

Q9H2H8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPIL3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_570981

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AQP1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
12214064 1.0 µg DNA

AQP1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
A1BG (Alpha-1B-glycoprotein, Alpha-1-B Glycoprotein) (APC)
122767-APC 100 µL

A1BG (Alpha-1B-glycoprotein, Alpha-1-B Glycoprotein) (APC)

Sign In for Pricing
View Details
ELISA Kit For Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma
E6845r 96 Tests

ELISA Kit For Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma

Sign In for Pricing
View Details
Histone H3 (tri methyl K4, serotonyl Q5) Rabbit pAb, Biotin conjugated
orb2405899 100 µL

Histone H3 (tri methyl K4, serotonyl Q5) Rabbit pAb, Biotin conjugated

Sign In for Pricing
View Details
Recombinant Candida glabrata Shugoshin (SGO1), partial
MBS1297747 Inquire

Recombinant Candida glabrata Shugoshin (SGO1), partial

Sign In for Pricing
View Details
Anti-EpCAM Antibody / Extracellular domain
V3525IHC-7ML 7 mL

Anti-EpCAM Antibody / Extracellular domain

Sign In for Pricing
View Details