Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TWF2 Rabbit Polyclonal Antibody (HRP)

TWF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A6r, A6RP, PTK9L, MSTP011

UniProt

Q6IBS0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TWF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IGDGAELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIRGPGENG

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009215

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERBB3 Protein (C-His, Human)
P520430 100 µg

ERBB3 Protein (C-His, Human)

Sign In for Pricing
View Details
MFGE8 protein
30R-3261 0.1 mg

MFGE8 protein

Sign In for Pricing
View Details
HSPA13 3'UTR GFP Stable Cell Line
TU060263 1.0 mL

HSPA13 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-Kv7.1/KCNQ1 K+ Channel Antibody FL490 Conjugate
75-081-FL490 200 µL

Anti-Kv7.1/KCNQ1 K+ Channel Antibody FL490 Conjugate

Sign In for Pricing
View Details
RAC1 Rabbit Polyclonal Antibody (Biotin)
orb2101036 100 µL

RAC1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
DFNB81 Protein Vector (Human) (pPM-C-HA)
PV073155 500 ng

DFNB81 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details