Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAC1 Rabbit Polyclonal Antibody (Biotin)

RAC1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MIG5, MRD48, Rac-1, TC-25, p21-Rac1

UniProt

P63000

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAC1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_008839

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
BNC470178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse IL12B/IL-12 p40 Protein, C-His
EMD84002 100 μg

Recombinant Mouse IL12B/IL-12 p40 Protein, C-His

Sign In for Pricing
View Details
FITC-Labeled Monoclonal Anti-FMC63 Antibody, Mouse IgG1 (Y45) (HEK293)
FM3-FY45P1-200tests 200 Tests

FITC-Labeled Monoclonal Anti-FMC63 Antibody, Mouse IgG1 (Y45) (HEK293)

Sign In for Pricing
View Details
Goat CUB and sushi domain-containing protein 3 (CSMD3) ELISA Kit
MBS7246639-01 48 Well

Goat CUB and sushi domain-containing protein 3 (CSMD3) ELISA Kit

Sign In for Pricing
View Details
Goat CUB and sushi domain-containing protein 3 (CSMD3) ELISA Kit
MBS7246639-02 96 Well

Goat CUB and sushi domain-containing protein 3 (CSMD3) ELISA Kit

Sign In for Pricing
View Details
Goat CUB and sushi domain-containing protein 3 (CSMD3) ELISA Kit
MBS7246639-03 5x 96 Well

Goat CUB and sushi domain-containing protein 3 (CSMD3) ELISA Kit

Sign In for Pricing
View Details