Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNQ1887 Rabbit Polyclonal Antibody (HRP)

UNQ1887 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IMP2, PSH1, PSL4, PRO4332, MDHV1887

UniProt

Q3MJ04

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UNQ1887

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_620584

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Atp6v1b2 activation kit by CRISPRa
GA200333 1 Kit

Mouse Atp6v1b2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human PGD protein (His tag)
PDEH101015-01 20 µg

Recombinant Human PGD protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PGD protein (His tag)
PDEH101015-02 100 µg

Recombinant Human PGD protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PGD protein (His tag)
PDEH101015-03 500 µg

Recombinant Human PGD protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PGD protein (His tag)
PDEH101015-04 1 mg

Recombinant Human PGD protein (His tag)

Sign In for Pricing
View Details
Mouse Ap3s2 activation kit by CRISPRa
GA200217 1 Kit

Mouse Ap3s2 activation kit by CRISPRa

Sign In for Pricing
View Details