Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM184A Rabbit Polyclonal Antibody (HRP)

TMEM184A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SDMG1

UniProt

Q6ZMB5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TMEM184A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001091089

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-ATM (pS1981) Antibody
MBS4504802-01 0.05 mL

Rabbit anti-ATM (pS1981) Antibody

Sign In for Pricing
View Details
Rabbit anti-ATM (pS1981) Antibody
MBS4504802-02 0.1 mL

Rabbit anti-ATM (pS1981) Antibody

Sign In for Pricing
View Details
Rabbit anti-ATM (pS1981) Antibody
MBS4504802-03 5x 0.1 mL

Rabbit anti-ATM (pS1981) Antibody

Sign In for Pricing
View Details
UPP1, Recombinant, Human, aa1-310, His-Tag (Uridine phosphorylase 1, UP, UPASE, UPP, UrdPase 1)
351565-01 50 µg

UPP1, Recombinant, Human, aa1-310, His-Tag (Uridine phosphorylase 1, UP, UPASE, UPP, UrdPase 1)

Sign In for Pricing
View Details
UPP1, Recombinant, Human, aa1-310, His-Tag (Uridine phosphorylase 1, UP, UPASE, UPP, UrdPase 1)
351565-02 250 µg

UPP1, Recombinant, Human, aa1-310, His-Tag (Uridine phosphorylase 1, UP, UPASE, UPP, UrdPase 1)

Sign In for Pricing
View Details
PLOD2 Mouse Monoclonal Antibody [Clone ID: LBI6D1]
AMM15870V 100 µL

PLOD2 Mouse Monoclonal Antibody [Clone ID: LBI6D1]

Sign In for Pricing
View Details