Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP3 Rabbit Polyclonal Antibody (HRP)

FKBP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FKBP-3, FKBP25, PPIase, FKBP-25

UniProt

Q00688

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002004

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSB (ERCC6) (NM_000124) Human Over-expression Lysate
LC424915 20 µg

CSB (ERCC6) (NM_000124) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS702498 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
DEF6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D1]
TA505352AM 100 µL

DEF6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D1]

Sign In for Pricing
View Details
OGA antibody
FNab05164 100 µg

OGA antibody

Sign In for Pricing
View Details
NDRG2 (NM_201539) Human Over-expression Lysate
LC404446 20 µg

NDRG2 (NM_201539) Human Over-expression Lysate

Sign In for Pricing
View Details
Involucrin (SY5), CF647 conjugate, 0.1mg/mL
BNC470678-500 1x 500 µL

Involucrin (SY5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details