Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBP2 Rabbit Polyclonal Antibody (HRP)

GBP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P32456

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GBP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAILLS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004111

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Embigin, EMB
11-4013-25 25 µg

Polyclonal Antibody to Embigin, EMB

Sign In for Pricing
View Details
Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial
RPC28454-01 20 µg

Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial

Sign In for Pricing
View Details
Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial
RPC28454-02 100 µg

Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial

Sign In for Pricing
View Details
Trak2 3'UTR Luciferase Stable Cell Line
TU222383 1.0 mL

Trak2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CD19 Rabbit Monoclonal Antibody
E56G0793 100 µL

CD19 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rat Znf16l-ps1 Pre-designed siRNA Set A
SI216515A 1 Each

Rat Znf16l-ps1 Pre-designed siRNA Set A

Sign In for Pricing
View Details